SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334180|ref|YP_001515352.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334180|ref|YP_001515352.1|
Domain Number 1 Region: 181-641
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.16e-122
Family Amylase, catalytic domain 0.00000000441
Further Details:      
 
Domain Number 2 Region: 649-752
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.04e-35
Family alpha-Amylases, C-terminal beta-sheet domain 0.00035
Further Details:      
 
Domain Number 3 Region: 14-116
Classification Level Classification E-value
Superfamily E set domains 6.82e-20
Family E-set domains of sugar-utilizing enzymes 0.006
Further Details:      
 
Domain Number 4 Region: 140-196
Classification Level Classification E-value
Superfamily E set domains 0.0000000105
Family E-set domains of sugar-utilizing enzymes 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158334180|ref|YP_001515352.1|
Sequence length 769
Comment glycogen branching protein [Acaryochloris marina MBIC11017]
Sequence
MSTPLTADQVNRIVWNHHHDPFEVLGPHPSQDGKSGWVVRAYWPKADAISVVCPEHRQEY
PMQSVHDPHFFECEVPIPGALNYQLRVKEGSHEQVLYDPYAFKSPRVTEYDQHLFAEGNH
HRIYEKLGAHLTTLDGVEGVYFALWAPNARNVSLLGDFNAWDGRQHQMRKGPSGIWELFI
PELSIGEHYKYEVKNYEGHIYEKSDPYGFQQEVRPKTASIVTDLNSYSWSDESWMEQRRN
ADALAQPISIYEVHLGSWMHASSDEPPTSEEGHPLPPVIVSELKPGARFLTYRELAERLI
PYVKDLGFTHIELLPVAEHPFDGSWGYQVTGYYACTSRYGTPEDFMYFVDQCHQQDIGVI
VDWVPGHFPKDGHGLAFFDGTHLYEHADPRKGEHKEWGTLVFNYSRKEVKNFLIANALFW
FDKYHIDGIRVDAVASMLYLNYCRKDGEWVANEYGGAENIEAADFLRHLNDVLFSYYPGI
LSIAEESTSWPMVSWPTYVGGLGFNLKWNMGWMHDMLDYFNMDPWFRQFHQNNVTFSIMY
AFSENFMLALSHDEIVHGKSNMLGKMPGDEWQKFANLRCLYTFMFTHPGKKTLFMSMEFG
QWSEWNVWGDLEWQLLQYDPHQNLKKFVTDLNHLYKELPALFTNDFSYDGFEWVDCNDNR
HSVISFVRRAKDSDEFVLTVCNLTPQPHSHYRVGVPEAGYYVERFNSDGRQYGGSNMGNL
GGKWTDEWAFHNRPYSLDLCLPPLATLVFTLDREKTAQAYQQLPDSQNQ
Download sequence
Identical sequences B0C0R4
gi|158334180|ref|YP_001515352.1| WP_012161599.1.67183 329726.AM1_0996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]