SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158334333|ref|YP_001515505.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334333|ref|YP_001515505.1|
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily IHF-like DNA-binding proteins 1.07e-31
Family Prokaryotic DNA-bending protein 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158334333|ref|YP_001515505.1|
Sequence length 91
Comment DNA-binding protein HU [Acaryochloris marina MBIC11017]
Sequence
MNKGELVDAIADKTGVTKKQADVTLSAAVDVIIDAVSHGDKVTLVGFGSFEPRDRKARNG
RNPQTGKKLKIPATRVPAFSAGKLFKDKVAP
Download sequence
Identical sequences B0C2X5
329726.AM1_1154 gi|158334333|ref|YP_001515505.1| WP_010468395.1.53659 WP_010468395.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]