SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334336|ref|YP_001515508.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334336|ref|YP_001515508.1|
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily CheY-like 6.26e-42
Family CheY-related 0.00045
Further Details:      
 
Weak hits

Sequence:  gi|158334336|ref|YP_001515508.1|
Domain Number - Region: 170-372
Classification Level Classification E-value
Superfamily PP2C-like 0.00314
Family PP2C-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158334336|ref|YP_001515508.1|
Sequence length 375
Comment two-component response regulator [Acaryochloris marina MBIC11017]
Sequence
MVKILIIDDDPITQLLLRRTLEKQGYQVTVASDGQEGLSKAQQLCPALIICDWMMPVLDG
IGVCQQLKSNPQLSATFFILLTSRSDLEDRIAGLNAGADEFLTKPIDMSELRARVRAGLR
LYHLNQDLHEQKQRLEAELAEAAQYVRSILPAPLQSPIQIQSRFIPSSQLGGDCFDYYWL
TPDTLILYLLDVSGHGLGAALPSVSILNMLRSQAFPGINYQHPHEVLHALNQRFTMSPEN
PKYITIWYGVYHRSRQELVFSSAGHPPALLMSTSEPEVQTLKTPGLPLGMFAEFTYQSQS
CNITPHQTLYIFSDGIYEIPKTNNQLLGLEGFSHVLQQLHQIGSPTIETILDQVQICCKH
QRFTDDLSLMQVVFP
Download sequence
Identical sequences B0C2X8
gi|158334336|ref|YP_001515508.1| 329726.AM1_1157 WP_012161743.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]