SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334368|ref|YP_001515540.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158334368|ref|YP_001515540.1|
Domain Number - Region: 7-110
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0195
Family The homologous-pairing domain of Rad52 recombinase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158334368|ref|YP_001515540.1|
Sequence length 156
Comment hypothetical protein AM1_1189 [Acaryochloris marina MBIC11017]
Sequence
MKTELLDQLKAPFPAADHQDRTLPGGGKWFFIPWQRIRKRLNEVCPDWSVSYSDPVIVGE
YVVVRCQLTLDGLTREGVGNDKAYPEKQTYGTPIERAIADAFKNAAEQFGVGAYLDNQEF
VIKHMQKQGDGRAYAYSDMRQQIRTQKNRQPLKKAG
Download sequence
Identical sequences B0C310
gi|158334368|ref|YP_001515540.1| 329726.AM1_1189 WP_012161775.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]