SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334414|ref|YP_001515586.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158334414|ref|YP_001515586.1|
Domain Number - Region: 21-62
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000106
Family Pentapeptide repeats 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158334414|ref|YP_001515586.1|
Sequence length 82
Comment hypothetical protein AM1_1234 [Acaryochloris marina MBIC11017]
Sequence
MDFTAMDSNEFIERYADGHRDFSGEFLEGLVLSRLLIQDLDLNGAILNNSEIVKTDIRGV
EFWALLNDGMTHAGIGTSPNLR
Download sequence
Identical sequences B0C412
gi|158334414|ref|YP_001515586.1| WP_012161818.1.67183 329726.AM1_1234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]