SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334425|ref|YP_001515597.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334425|ref|YP_001515597.1|
Domain Number 1 Region: 51-178
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 2.62e-36
Family L,D-transpeptidase catalytic domain-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158334425|ref|YP_001515597.1|
Sequence length 180
Comment hypothetical protein AM1_1246 [Acaryochloris marina MBIC11017]
Sequence
MRHSSIKLIALSVVAGALALGQPVRAVEEIAIAPPLPGLDNVTDHLPPAVDPMRLELNLS
KRRVTVYQHDQAVKSYPVAIGRAGWATPAGDFEVKTKYRNPPWLHPFKGYVIPGGDPENP
LGRRWMGFWTDGNNWIGFHGTPNRDSVGRSASHGCVRMYDEDIEEMYELVAVGTPVKVIR
Download sequence
Identical sequences B0C423
329726.AM1_1246 gi|158334425|ref|YP_001515597.1| WP_010480594.1.53659 WP_010480594.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]