SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334608|ref|YP_001515780.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334608|ref|YP_001515780.1|
Domain Number 1 Region: 21-263
Classification Level Classification E-value
Superfamily YjeF N-terminal domain-like 4.97e-59
Family YjeF N-terminal domain-like 0.00013
Further Details:      
 
Domain Number 2 Region: 245-513
Classification Level Classification E-value
Superfamily Ribokinase-like 6.54e-52
Family YjeF C-terminal domain-like 0.0000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158334608|ref|YP_001515780.1|
Sequence length 521
Comment carbohydrate kinase [Acaryochloris marina MBIC11017]
Sequence
MQDKNIEQHINERFTQIQKTVVTAQQMRRIESRIFKAGMPVSALMEKVGGLIARRIQALY
PYGDMPRIGILAGPGHNGGDAFVVARELYFQGYEIRLCRPLPRSKDLTEQHAQYAASLGM
EIGQGVDVLQSCDVIVDGLFGFGLERGIEGAIADLIHQLNTWSQPVISIDLPSGIHTDTG
AVLGAAIQATHTLCLGLWKLGLLQDQSLPYSGHLHLIDFDIPVADINAVLGDMPDIHRMT
SVTAKKGLPTQRHPNTHKYRQGHCLLVGGSQKYAGSIILSALGARATGVGMMTIAVPASL
KPLVLQSVPEALVIGCPETEQGAIASLPPELLLDSFNAIAYGPGVTTETNAILSAVLACA
CPLVLDADGINLLAQYRPLETLQARLAPTILTPHPGEFKRLFSDKPSQELLSVVRRAAQS
SNAYIVYKGARVILAPPQGAVWINPDSTPALARGGSGDVLTGIFSGLLSQRLDDQATSEI
LCSGIWWHAQAGLFAARQRTELGVDPLTLCQSLISAIASQP
Download sequence
Identical sequences B0C7S5
gi|158334608|ref|YP_001515780.1| 329726.AM1_1438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]