SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334645|ref|YP_001515817.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158334645|ref|YP_001515817.1|
Domain Number - Region: 148-330
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000217
Family Phosphate binding protein-like 0.039
Further Details:      
 
Domain Number - Region: 451-542
Classification Level Classification E-value
Superfamily OmpA-like 0.000262
Family OmpA-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158334645|ref|YP_001515817.1|
Sequence length 559
Comment nitrate/sulfonate/bicarbonate ABC transporter periplasmic protein [Acaryochloris marina MBIC11017]
Sequence
MATELDIERKAGDEGDRKYCWQCDFVTRMHMTKCIVCGAPLYDKPKHKRITQPQSNLPSD
DKAKRPNKKTTVLLSFLLFAGAVSAAIALISPWKRATEPVASPGPANIEVLGDTFLGYST
LWDQDFQKKLKDAEITIGYADELDQETRSQKLSSGEVDFMVTTINQLFETPNTGKIVAMW
DWTRGADRLVLNNKQFPQVTTIQGLNRAATQAAQQGELLSIIFAGNTPSEYLSILLADKS
PDFALEKFNIIRVDDSSTAWQRFQNPKPGENIVAGIFWEPYVTQANRAGYIPSLSSAHVQ
RSIVDVVVASPQVLKEHPGKVQEFVKAYYEHISRRAIDKTAWRQQFENLGGLTASESLNF
LQGVYFFDANCANHWMNGPTKLLRQRLNYTKQVLYGSGRLTATPNNVDQLYDGRFVAELA
TSDAAASCPALQSTAKPAPTPKPAPASSTPQQTEAKATTTTQTTIAIQFEVGAAQLNDQA
KKSLDQVLDTANPDDTVRITATFADASSARALALLKSRATAVEQYVVDKLPTASVQTTLN
SGGSESPNIRVSIGKGFTP
Download sequence
Identical sequences B0C7W2
gi|158334645|ref|YP_001515817.1| WP_012162032.1.67183 329726.AM1_1475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]