SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334820|ref|YP_001515992.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334820|ref|YP_001515992.1|
Domain Number 1 Region: 234-290,332-566
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.66e-30
Family FAD-linked reductases, N-terminal domain 0.089
Further Details:      
 
Domain Number 2 Region: 823-873
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000000575
Family GSPII protein E N-terminal domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 754-815
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000186
Family GSPII protein E N-terminal domain-like 0.025
Further Details:      
 
Weak hits

Sequence:  gi|158334820|ref|YP_001515992.1|
Domain Number - Region: 64-223
Classification Level Classification E-value
Superfamily Heme oxygenase-like 0.00161
Family TENA/THI-4 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158334820|ref|YP_001515992.1|
Sequence length 893
Comment hypothetical protein AM1_1657 [Acaryochloris marina MBIC11017]
Sequence
MKEILELIENNRSNFSELNLFRFLRNQSINPVKRLAFAPCISPFVMSFGDLNKYVLQQHP
TSDKIQEIINQHTAEEHNHWNWFLEDIQALGYDFNINFNSTLKFLWSEETKSARWISYQL
YRFIYDADSIQKLVVLEAMEATSSVFFSEISKVAEELYKTKSIKCRYFGEHHLKAEESHS
AFMPETDDYINKIFIPQKRKEELATIVNQIFNLFSDLTESFFQYAIKYQDNSFPLNSYCS
QSYDYEYIIIGAGPAGLQLGYFLENSNRDYTILESGDSPGTFFKDYPRHRKLISINKRNT
GYSDPEINLRWDWNSLLTQDYSKNFTDYSKKYFPSADNLVEYFNDYAKEFSLNIKYGVTV
EKISKNQGFVLLDSYGNTYSCKYLVIATGCPKLYIPEISGIELAEKYTDVSVNPEDFENQ
RVLIIGKGNSAFETADNLIDTAVTIHICSPSPVTMAWKTKYVGHLRAVNNNFLDTYQLKS
QNAILDAEILGIRKNRNEYVVNVKYSHANGESEELVYDRIILCTGFRFDDSIFDVTCKPA
LTINNRYPAQTSEWESTNIQDLYFAGILMHMRDFKKKQSGFIHGFRYNIRTLHRIFEHKH
HHAPLPSRKIPLSPQAITDFIIDRVNTSSSLWQQTDFMCDLITVSDDSQEVQYFDELTKD
YIHEGYLGRHEHYYTVSLEFGQNVADITDPFAIDRVHKEDAFNSSQSEFIHPVIRRFHKN
TLIAEHHVIEDLASEWKEDVHIQPLLKFMTEQLTHSQGIGAHLLEAGLLTSEQLEVALED
QERQATARLGEVIQKRGWVKERTIQFLLNQVNNTLVDHPALNACTQLGNNLVEAGLLTSA
QVDEAIQEQKISNKRLGEILVNHGWVNSQTIEYMMKHLSKANATAQPEVAVMN
Download sequence
Identical sequences B0CB39
gi|158334820|ref|YP_001515992.1| 329726.AM1_1657 WP_012162197.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]