SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334821|ref|YP_001515993.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334821|ref|YP_001515993.1|
Domain Number 1 Region: 110-388
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.62e-66
Family Alanine racemase-like, N-terminal domain 0.0024
Further Details:      
 
Domain Number 2 Region: 444-601
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000000000488
Family Eukaryotic ODC-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158334821|ref|YP_001515993.1|
Sequence length 674
Comment arginine decarboxylase [Acaryochloris marina MBIC11017]
Sequence
MENGRNREDRATKISQTLAAELENGHSAPMRERPLTSDPNPEQTDAAWSIEESEKLYRIR
GWGEPYFSVNAAGHVTVSPKADRGGSLDLYELVQSLQQRDIHAPLLIRFSDILADRIERL
NACFAKAIARYSYPGRYRGVFPVKCNQQRHLVEDLVRFGQPHQFGLEAGSKPELLIAIAS
LKTSGALLICNGYKDLEYVETAMLAQRLGHQAIIVIEQLEEVELVIEASRRLQIQPILGV
RAKLSAKGIGRWGTSAGDRAKFGLNIPEVVAAVEHLRAANLLNSLQLLHFHIGSQISAIS
VIKDALREASQIYVELARLGANMKFLDVGGGLGVDYDGSKSNSAASKNYNMQNYANDVVA
EVKEACAEADIPVPTLVSESGRAIASHQSVLIMNVLGSSDTLNLTPEPAQADEHLIIRNL
WETYQTIDTENYQEAYHDALQFKEEAVSLFGFGYLSLEGRARVERLCGACCQRILAIARK
DDDVAVDLEDLERRMASLYYTNLSVFQSAPDTWAIDQLFPIMPIHRLEEEPTQRGTLVDL
TCDSDGKIDQFIYSRDTKPILELHTLKPNEPYYLGMFLNGAYQEVMGNLHNLFGDTNVVH
IDLTPMGYHIAHVVKGDTITEVLEYVQYDADDLIEEIRKQSEVALQEQHITLPEAQLLLK
NYERSLRSYTYLKS
Download sequence
Identical sequences B0CB40
gi|158334821|ref|YP_001515993.1| WP_012162198.1.67183 329726.AM1_1658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]