SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334880|ref|YP_001516052.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334880|ref|YP_001516052.1|
Domain Number 1 Region: 8-161
Classification Level Classification E-value
Superfamily RNase III domain-like 1.38e-32
Family RNase III catalytic domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 119-238
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.89e-17
Family Double-stranded RNA-binding domain (dsRBD) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158334880|ref|YP_001516052.1|
Sequence length 247
Comment ribonuclease III [Acaryochloris marina MBIC11017]
Sequence
MASCPPQRQRQLEKLIQRLGLPGNAPIRWDLLDLALTHPSASGRANYEQLEFVGDSVVRL
LAAVLLQAENAQGSVGEWSAIRSVLVSDRHLATLAANYGLDRFLLLGPSTLKDRRGQDSR
LADAFEAVLGALYLSTGDLSLIQPWLQDPLRNKAEQVRIDPAYQNYKAALQQWTQAVYQQ
LPEYRVQETSPPSQDPSDVMADRFTAEVWLQEELLGVGKGHSIKAAEKAAAQIAFLKVQS
PLAETEF
Download sequence
Identical sequences B0CB99
329726.AM1_1717 WP_012162255.1.67183 gi|158334880|ref|YP_001516052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]