SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334883|ref|YP_001516055.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334883|ref|YP_001516055.1|
Domain Number 1 Region: 21-239
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.18e-51
Family PP-loop ATPase 0.00027
Further Details:      
 
Domain Number 2 Region: 218-331
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 1.09e-17
Family MesJ substrate recognition domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158334883|ref|YP_001516055.1|
Sequence length 338
Comment tRNA(Ile)-lysidine synthase [Acaryochloris marina MBIC11017]
Sequence
MINSPPWTPLHAHLHHILKVRQLLPIQQRILIALSGGQDSFCLLQLLVDLQPKWGWQLAI
AHGDHRWPLDSDANAHHVTQIARQYQLPYFLRQATTELRSEAAGRQWRYQILTEIAEQEA
YPLVVSAHTASDRAETLLYNLIRGSGTDGLQALSWQRPLSDRVQLVRPLLDVARAQTGDF
CRHRNLPIWQDAMNQNLVYRRNRIRLEVLPHLKTHFNPQVETTLAHTAEILQGDVDFLEA
ETQKLLAIALPSPPPVLSETEQYWGYINRDALQSAPLALQRRALRHFLRQAIDVSANFQQ
IEKLMALVKAPNHSRTDPFKKQWVAEVIKPWIVIRSLS
Download sequence
Identical sequences B0CBA2
WP_012162258.1.67183 329726.AM1_1720 gi|158334883|ref|YP_001516055.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]