SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334898|ref|YP_001516070.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334898|ref|YP_001516070.1|
Domain Number 1 Region: 5-332
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 9.07e-98
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158334898|ref|YP_001516070.1|
Sequence length 336
Comment tryptophanyl-tRNA synthetase [Acaryochloris marina MBIC11017]
Sequence
MGKQRVLSGVQPTGTLHLGNYLGAIRNWVEGQSNYENYFFIADLHAITVPHDPQQLADNT
YSLAALYLACGLDPEHTTIFVQSHISAHAELAWLFNCITPLNWLERMIQFKEKALKQGEN
VSIGLLDYPVLQAADILLYQADLVPVGEDQKQHLELTRDIAARLNFQYGTEENPILKVPE
PLIRPEGARIMSLTDGTNKMSKSDPSEQSRITLLDTPDQIRNKIKRCKTDPVRGLSFDDP
DRPECQNLLTLYQLMSGQAKTAVAEECAEMGWGQFKPLLTEVMIEGLRPIQDRYTALMTN
KQDLEGVLQQGKDQASEIANKTLTKVKDALGYSRPL
Download sequence
Identical sequences B0CC71
gi|158334898|ref|YP_001516070.1| WP_010477865.1.53659 WP_010477865.1.67183 329726.AM1_1736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]