SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334930|ref|YP_001516102.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334930|ref|YP_001516102.1|
Domain Number 1 Region: 297-499
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.88e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000399
Further Details:      
 
Domain Number 2 Region: 831-1025
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.62e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000653
Further Details:      
 
Domain Number 3 Region: 566-670
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 9.42e-33
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00024
Further Details:      
 
Domain Number 4 Region: 137-183,275-331
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.79e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.002
Further Details:      
 
Domain Number 5 Region: 39-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 6.98e-25
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00013
Further Details:      
 
Domain Number 6 Region: 671-721,808-857
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.46e-23
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0014
Further Details:      
 
Domain Number 7 Region: 722-805
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.31e-22
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00039
Further Details:      
 
Domain Number 8 Region: 184-273
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 8.89e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158334930|ref|YP_001516102.1|
Sequence length 1058
Comment RND multidrug efflux transporter [Acaryochloris marina MBIC11017]
Sequence
MLVNFFIKRPVLTTVCALLILLMGLVCLPTLPIAQYPDISPKQVSIQANFIGADAATVED
GVTSILEREINGVEGLRYMTSSSSNSGSSSITATFENNRDQDLAAVDVQNRVSSVESQLP
AAVQQTGVRVTKQSSSILMGFGLFSEDDEYDSIFLSNYADLYLTNALKRVNGVGNVTIFG
ERKYAMRLWLDPERLAKRNLTGQDVVDALQEQNIQVGAGQIGQPPAPEGQQFQIDIRAES
RLNTIEEFEALVVDSTDGNLIKLQDVGRVELGAENYGSFLRFRGKDAVGLGISQIPGSNA
LDVARGVKETMATLSEDFPPGMTYDIGFDTTDYVEQSLTEVIWTLIQAVGLVVLVIFVFL
QDWRTTIIPAVTIPISLIGTFVFVKLFGFSINSLTLFGLTLATGMVVDDAIVVVENVAAK
IQNEGIEPRQAAIVAMEELTGAVIATSLVLMAVFVPVAFFPGTTGALYQQFALTIAFAIS
LSTFNALTLTPTLSGLLLRQNPSIPDWIAPAFNWFNRQQDRLRQSYGNILDWMNRFKYFI
LAIFAALLTFTAWIYTTVPSAFLPEEDQGYFLTIVGAPDGVSLEYTSDVMKKIEEVMLPL
PEVRATFAVGGFSFGGNASNKGIVFTTLKPWSERRSSEQSAQAIINRVRGQLFQIPEARI
LAINPPAIRGLGSYGGFTFQLQDRSENLSLDEFVSNLGPVLGAANSNDALEGAFTTYGAN
TPQLKVEVNRQRAKALQVDVDEIFNTLQIYLGSRYVNDFNLGRRTYRVYVQADQQFRSNP
DDIGKLYVRSGTDQMIPLSNLVTITSVTGAQTINHYNQFRSIEINGAAKAGVSSGQALQA
MEEIAAKVLPPGLGFEWSGISLEEIESGGQATIIFSLGLVLVFLVLAAQYESYVDPVIIM
LSVPLAVLGALGAQVLRGFSNDIYCQIGLVMLIGLASKNSILIVEFANQLREEGLPIPKA
ALQAAQQRLRPILMTAISTLSSIFPLVVASGAGAGSRQSLGTAVFGGMFVATFLSLFVVP
ILYIIIKGFSDRISPKTAELTPTTEVLGAEENLTVIRK
Download sequence
Identical sequences B0CCA3
WP_012162300.1.67183 329726.AM1_1767 gi|158334930|ref|YP_001516102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]