SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158335027|ref|YP_001516199.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335027|ref|YP_001516199.1|
Domain Number 1 Region: 355-538
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.52e-60
Family Pyruvate oxidase and decarboxylase PP module 0.0000376
Further Details:      
 
Domain Number 2 Region: 1-171
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.08e-54
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000211
Further Details:      
 
Domain Number 3 Region: 179-348
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.12e-40
Family Pyruvate oxidase and decarboxylase, middle domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158335027|ref|YP_001516199.1|
Sequence length 545
Comment acetolactate synthase [Acaryochloris marina MBIC11017]
Sequence
MNTAELLVKCLENEGVEYIFGLPGEENLQVLEALRDSSIQFITTRHEQGAAFMADVYGRL
TGRAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRMHIESHQYLDLVAMFNP
VTKWNSQIVRPSNTPEIVRRAFKRAQTEKPGAVHIDLPENIAAMPAEGMPLQQDSLKRSF
ASPRNLEQAAEIISQATNPLILVGNGAIRANASEALTQFATELNIPVANTFMGKGVIRYT
HPLALWTVGLQQRDYISCGFDRTDLVIAVGYDLIEFSPKKWNPDGTIPIVHVGAEPAEID
SSYIPKTEVVGDISDSLIEILRRADRQGKPDPYGVELRPQIRADYEEYAKDEHFPLRPQK
LIYDLREVLASEDIVISDVGAHKMWMARHYHCDRPNTCLISNGFAAMGIAIPGALAAKLV
YPDRHVVAVTGDGGFMINMQELETALRLGVAFTTIIFNDGGYGLIEWKQQQYYGEASFIK
FGNPDFVRLAESMGLKGYRVESSADFMPCLKTALAQDVPTIVDCPIDYKENLMFSQKSGE
IACIN
Download sequence
Identical sequences B0CDG0
gi|158335027|ref|YP_001516199.1| 329726.AM1_1865 WP_012162388.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]