SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158335326|ref|YP_001516498.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335326|ref|YP_001516498.1|
Domain Number 1 Region: 1-236,282-297
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.34e-73
Family Cytidylytransferase 0.014
Further Details:      
 
Domain Number 2 Region: 235-431
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 7.85e-30
Family gamma-carbonic anhydrase-like 0.015
Further Details:      
 
Domain Number 3 Region: 636-742
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.49e-21
Family Phosphoglucomutase, first 3 domains 0.0082
Further Details:      
 
Domain Number 4 Region: 744-830
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.000000000102
Family Phosphoglucomutase, C-terminal domain 0.01
Further Details:      
 
Domain Number 5 Region: 531-632
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.000000000322
Family Phosphoglucomutase, first 3 domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158335326|ref|YP_001516498.1|
Sequence length 844
Comment phosphoglucomutase/phosphomannomutase family protein [Acaryochloris marina MBIC11017]
Sequence
MRAVLMAGGEGTRLRPLTCDLPKPMVPILNRPIAEHIVNLLKHHQIYEIIATLYYLPDVM
RDYFRDGSDFGVQMTYGIEEEQALGTAGCVKNISALLTDTFLVISGDCITDFDLTAAIKF
HRQKGSKATLVLARVPDPMEFGVVITDQSHQICRFLEKPSTSEVFSDTVNTGIYILEPEV
LDYLPSDQQTDFSKDLFPLLLEKGEPMFGYVAEGYWCDVGSLDSYREAQYDALQGNVRIE
FAYQEMNPGLWMGQNVHVDPEAKLHPPILIGDNCRIGPRANIEAGTVIGDNVTIGNDADL
KRPIIWNGVLIGEEAHLRACGIARGARVDRRAHVLEGAVVGALSTVGEEAQVSPGVRVWP
SKHIEPGAALNINLIWGSTAPRNLFGQRGVAGLANVDITPEFAVKLGAAYASTLKPGSQV
TISRDQRSISRMVSRSLISGIMSVGIDVQNLEATALPIARCVPRNALVVGGVHVRIHPER
SDFILIEFFDEQGINISKAKEKKIEGAYFKEDFRRAPIGEIGGITYPGVLLDDYAQIFEK
WLNTAVVREGDFKVVIDYVYAVSGAVLPRLLSKFGCDAVVLNASLRTKGPTPEQREELLT
QLGPVVEALKANFGVQVAANGEQLLLVDETGSAIRGEQLTALMVEIILTANPRGTVVVPV
HTSSAVEQIARRHDANVIRTKVNPTALMETCWTNPNVVLGGSADTGFIFPQLHPGFDAMF
SIAKLIEMLTLQQKSLGQLKASLPRIFHRTQTVRCPWNRKGALMRYLVETHPAETLELID
GVKVKDPASDNWTLILPDASEPLVHIFANGGDREWVDATLREYRQRIQEFTERDPDLENN
LEES
Download sequence
Identical sequences B0BZX4
329726.AM1_2170 WP_012162662.1.67183 gi|158335326|ref|YP_001516498.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]