SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158335425|ref|YP_001516597.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335425|ref|YP_001516597.1|
Domain Number 1 Region: 14-175
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000000000085
Family Bifunctional DNA primase/polymerase N-terminal domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158335425|ref|YP_001516597.1|
Sequence length 519
Comment hypothetical protein AM1_2272 [Acaryochloris marina MBIC11017]
Sequence
MNSSTNNPQNFSSILDVAIGYLDLGSSPLPVAPKQPNSNFNGKNPSYLDEQGKAYLISSK
QYQNKQPTRTEIDLWFANPENGIGILGNNHLHIVDVDTKHFDSKEVCEQVVNKWLDKHSQ
LHDAQVERTLSDGFHIYVEFAEPPGFTRFAFSEGGSHVGEIQGPNQFTVVAPTVGYQVVQ
KGRFAPVIDAESIGLYSIKKAKKAKASRSDQVQKTVRIKPENSDALSLLELSTRGVQAIY
QSQPESDDRSKDITKVANELYGWANWCEANNLAYDPEPRTLLVDLASNLDIDEDRLDRII
DSIDIDDCQPACVYEGGDEAAWKKIKKLSVDVELEEVTTKILIDSTIIKPPQLFHKSLYG
PLSDLASNLELPVEAFLVCILPILASRLKAETRLIIDPGTGYHVPPIIWAGLVGESGTMK
SPILKLLTRPLSRLQQEVHESYQLEVSEYEKDLQRFQSRSKKLPITPEKPKHPNMRDLFF
SDFTIEAIADSICHHPSEGYLIHIDELAGFFKSMDAYRN
Download sequence
Identical sequences B0C124
329726.AM1_2272 gi|158335425|ref|YP_001516597.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]