SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158335526|ref|YP_001516698.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335526|ref|YP_001516698.1|
Domain Number 1 Region: 265-520
Classification Level Classification E-value
Superfamily PP2C-like 7.19e-49
Family PP2C-like 0.0000351
Further Details:      
 
Weak hits

Sequence:  gi|158335526|ref|YP_001516698.1|
Domain Number - Region: 8-33
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0235
Family Ran binding protein zinc finger-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158335526|ref|YP_001516698.1|
Sequence length 842
Comment protein phosphatase 2C domain-containing protein [Acaryochloris marina MBIC11017]
Sequence
MPHSQPQLQCPNLRCRAVNSDRDQFCQKCGTYLPKRFLWVVGARVDNFQVGDLLEDRFLF
QGPRVVFDTQPGIPLKMSVELPDTLVPYLKLFPYRLHLPQVYTLLSLGDPEPSLILLLEQ
APLGSADLDPSHQGGLALGAGMPLFDAWVNAQPLRQLHWLWQIAQLWQPLRIQGVASSLL
QPDFMRVEGSLFRLLELENDFRLEPSLADLGLVWQQLIPKTSGKLADSLDGLCDQLASGE
VESAEELLAQLESWIENIHKAYRVKIDIATRTDTGMVREHNEDACYPADGAVTQNSLERM
AIVCDGVGGHAGGEVASGIAIEALRDHLTQLPIDDLSPADVITELENASFKANDLISQRN
DQEQRQDRQRMGTTLVTALSQTHQIYVSHIGDSRAYLITTQGCYQIMVDDDIASREVRLG
YVPYREALLQPASGSLVQALGMASSSVLRPTVQRFLLDEDCLFLLCSDGLSDYDRIDMIW
REELLPLLQGGTDLASTSKRLIELANQLNGHDNVTVGLVHCHVTRQRQSTGATGLNSAPA
ETSAPVDNTPPTVLPKTQAVAPDAPLDPKRSGSGFGLWILLGLILLGVGGAVAYQLGFLK
LPFLNQPIADSSASPSPEPSLPDTPPPPPDLAQANKLDVLRLVSANDQPIEISVVKDPKE
LLQGIGGVDDASVDNPPTETSDAKIALGSTISIPSDSLVVVDGIFPPPLADASDKTAPGA
PIQALRIRTCQPVEEVSEQEGTGILPPEKLDEKLEKEGADPDADSVAQLIDEKLSDENPS
GSVTTPSTPQIGWVDRSKLASLVTEIIPAAQLSPEQQKACTPAPLEGKDIPAGAPIGSDP
TP
Download sequence
Identical sequences B0C337
gi|158335526|ref|YP_001516698.1| WP_012162854.1.67183 329726.AM1_2374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]