SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158335586|ref|YP_001516758.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335586|ref|YP_001516758.1|
Domain Number 1 Region: 406-603
Classification Level Classification E-value
Superfamily FtsH protease domain-like 8.5e-74
Family FtsH protease domain-like 0.00000237
Further Details:      
 
Domain Number 2 Region: 152-418
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.68e-72
Family Extended AAA-ATPase domain 0.0000000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158335586|ref|YP_001516758.1|
Sequence length 611
Comment ATP-dependent metalloprotease FtsH-like protein [Acaryochloris marina MBIC11017]
Sequence
MNKRWRNAGLYALLAIVVLALGTALLERQPADNPTWRYSKLIEEVENNNVEKIRISADRT
MAEVKSGEGVITVNLPPDPDFIDILTKQDVDIAVLPQREEGVWFKALSTFLVPVLLLVGL
FFLFRRAQSGPGNQAMNFGKSKARVQMEPQTQVTFNDVAGIEQAKLELTEVVDFLKNADR
FTAVGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSEFVEMFVGVGASRVRDL
FEQAKTNAPCIVFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLTEMDGFEGNTGIIIIAA
TNRPDVLDAALMRPGRFDRQVVVDRPDYKGRREILNVHARGKTLSKDVDLEKMARRTPGF
TGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKDRVMSERRKRLVAYHEA
GHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPNEDQMDSGLYSRSYLQNQMAVALGGR
IAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGMSDRLGPVALGRQQGNPFMGRDIMS
ERDFSEETASTIDDEVRNLVDQAYRRAKDVLVSNRAVLDEIARRLVEKETVDSDELQEIL
NTNEVKMAAIA
Download sequence
Identical sequences B0C453
WP_012162910.1.67183 gi|158335586|ref|YP_001516758.1| 329726.AM1_2436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]