SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158335744|ref|YP_001516916.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335744|ref|YP_001516916.1|
Domain Number 1 Region: 109-316
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.53e-19
Family ATP-binding domain of peptide synthetases 0.0087
Further Details:      
 
Weak hits

Sequence:  gi|158335744|ref|YP_001516916.1|
Domain Number - Region: 33-109
Classification Level Classification E-value
Superfamily PreATP-grasp domain 0.000978
Family D-Alanine ligase N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158335744|ref|YP_001516916.1|
Sequence length 330
Comment D-alanine--D-alanine ligase [Acaryochloris marina MBIC11017]
Sequence
MKIGLLFDSQAELMAAPEAQVNTHYHWREPEEVVAVTHALTDLGHTVDAIGSLESLLHRW
QQQDLPDLVWNLSVGALSRNRTALAPALLEHLGIPYTGGDAATKSLTLNKDWLKPVLEWC
GIATPPWRRFGLEESITELPPWPVSLLKPTCEGYSLGLQRFETQDGLAVLQKQVQQLQSQ
FQTAVLCEPLIAGREITVGVVGNLEPSLLGAVETLTTSGQALQEQVLDLQAKRQGGFQKV
NVDLADSDLQPLRSAALKLMNLLQPLDYATFDFRLGRGQAYLVDVNADATLHPLRSLAQI
AQAQKLTYPHLIKLILMTTCHRWSLSLTTP
Download sequence
Identical sequences B0C6P6
WP_012163056.1.67183 gi|158335744|ref|YP_001516916.1| 329726.AM1_2595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]