SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158335801|ref|YP_001516975.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335801|ref|YP_001516975.1|
Domain Number 1 Region: 169-304
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 5.01e-43
Family ATP-dependent riboflavin kinase-like 0.00027
Further Details:      
 
Domain Number 2 Region: 13-170
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2e-30
Family Adenylyltransferase 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158335801|ref|YP_001516975.1|
Sequence length 307
Comment riboflavin biosynthesis protein RibF [Acaryochloris marina MBIC11017]
Sequence
MWVTSSLETVRTPTVIALGNFDGIHQGHCQVIQSLLSNRSDTAQVTVVAFNPHPQAFFSG
EHQPLLTPLSEKATLLENLGVDQLVLIPFDQALANLSPQDFVKDILVAQLQAQFISVGFN
FCFGYQRAGTAEDLVAIAGQYQIPVSITAPQTNGSEPISSSAIREALLEGNLEKAQQMLG
RAYDLTGTVVKGQQLGRTLGFPTANLQVPTDKFCPRTGVYSVSVTSNLWSQPQPGVMNWG
CRPTVDGQQPSLEVHLLDWSGDLYGHTVTVHLQQFLRSEQKFASLADLKAQIQADCEIAR
ASLAAVV
Download sequence
Identical sequences B0C6V5
gi|158335801|ref|YP_001516975.1| 329726.AM1_2652 WP_012163110.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]