SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158335893|ref|YP_001517067.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335893|ref|YP_001517067.1|
Domain Number 1 Region: 22-100
Classification Level Classification E-value
Superfamily RelE-like 2.62e-19
Family YoeB/Txe-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158335893|ref|YP_001517067.1|
Sequence length 101
Comment addiction module antitoxin [Acaryochloris marina MBIC11017]
Sequence
MSKRKSNISDQPLTVFRRYANLSPQFREDLKALAQTEPKLYDRTWVIIDNTLEDPFKGIG
KPEPLKHIGSDIWSRRLSHEHRIVYVVRDERIDFIQAKYHY
Download sequence
Identical sequences B0C970
gi|158335893|ref|YP_001517067.1| WP_012163198.1.67183 329726.AM1_2751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]