SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158335957|ref|YP_001517131.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335957|ref|YP_001517131.1|
Domain Number 1 Region: 105-553
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 5.44e-104
Family Cellulases catalytic domain 0.00000104
Further Details:      
 
Domain Number 2 Region: 15-105
Classification Level Classification E-value
Superfamily E set domains 2.73e-19
Family E-set domains of sugar-utilizing enzymes 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158335957|ref|YP_001517131.1|
Sequence length 556
Comment cellulase [Acaryochloris marina MBIC11017]
Sequence
MAKWVCSQQLAEDFAPKIVLNQVGYRANWDKVAFLLNAEDNAPITTNVIDRQSGKTVATI
QPGPAELDEQSRDRIQTLDFSNFKRSGEYYLQAGDLKSVPFQIGQDIYQDTFTKLLRTYY
LQRCGVAIFDPITGIYHPPCHLKDAVIAHDDAFHKAGDTVQSQGGWHDAGDYGKYVATTT
VTIGSLFSLYEQYPQNFTDDQLDIPESGNQLPDLLDEMKVGLDWLLSTQRQDGGVYRKLS
GKEWPIGKAPDEDKQTRYLYGVSTPETGKFAAVMAMAGRIYKDPQQAKTYLDAAQLAWDY
LQTQDQMQEGWIDGDDSGSGKYLLSEIDIEDSLKTDIDDRYWAAAELFLTTGDSKFEQYL
VDHFDQMPFNLYEWKDASTLGMVDYLFYAKADPNQLKPQIQQKLLDRADQIMGRVEGSGY
RLANHRFIWGSNKMTVEEGITLVHAYHLTQEQKYKEAALDQLHYMMGRNHFDQTFVTGVG
THPVAKVNHLFARAKQINIPGLVVGGPNDGAQDNIAPKGLGIRSYLDSEKSYATNEYAID
YNAPLITLLGMLLETS
Download sequence
Identical sequences B0C9D4
gi|158335957|ref|YP_001517131.1| WP_012163260.1.67183 329726.AM1_2816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]