SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158336117|ref|YP_001517291.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336117|ref|YP_001517291.1|
Domain Number 1 Region: 27-427
Classification Level Classification E-value
Superfamily Clc chloride channel 1.03e-62
Family Clc chloride channel 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158336117|ref|YP_001517291.1|
Sequence length 465
Comment voltage gated Cl- channel protein [Acaryochloris marina MBIC11017]
Sequence
MTQTLASGPEEQHALSAPFEIGKRELTYSQLVICAALIGVFGGLVATAYYFVLETLMHGV
WHTVPDRVVPYFPSWLPQQHYVWIASTIGGFCVGLVLFFMGLPGEMAQVVDKIHSPGKID
IRKTPAMIIASLVAITSGGSAGPEAPLVQVNGSFGSWLGEKLQLTTTSVRVLTFCGMSAA
LGAFFGAPIGAALFALEIPHRKGLEYYEAIAPAVVSAIFSFAVFRINTGMTIGGFYHFET
VPPLTPTNLLEGLVLGGIGAGVAVMFIGVFRLVGHLLAPLEHHRILLATLGGLTIGLIAL
AFPQTLFFSEEQIHTVIETGATLGITFLLMIAVAKMFAISVTLHSGFLGGFIFPLFFIGA
NVGLAISLMVPQVHPTLGMVCLMAAVNVAVTKTPVSTSIILSVLSGMAMLPVIVISSFVS
FLLTSQIAMIKTQRSRELEGFPTSAPQTSEASPRLVSSPASLAIE
Download sequence
Identical sequences B0CCE6
WP_012163408.1.67183 329726.AM1_2979 gi|158336117|ref|YP_001517291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]