SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158336122|ref|YP_001517296.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336122|ref|YP_001517296.1|
Domain Number 1 Region: 134-305
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.07e-48
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000475
Further Details:      
 
Domain Number 2 Region: 389-506
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.16e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000204
Further Details:      
 
Domain Number 3 Region: 9-131
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.89e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.00042
Further Details:      
 
Domain Number 4 Region: 547-644
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.24e-26
Family 2Fe-2S ferredoxin-related 0.012
Further Details:      
 
Domain Number 5 Region: 303-375
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.99e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158336122|ref|YP_001517296.1|
Sequence length 645
Comment ferredoxin-nitrite reductase [Acaryochloris marina MBIC11017]
Sequence
MTNTAPAAPKMNKFERFKAEKDGLAVLPELSHFAQIGWEAMDETDLTQRLKWLGLFFRPV
TPGKFMLRMRMPNGILSGGQMRVLAEVIQRYGEDGYADITTRQNIQLRGIRIEDIPDIFN
RFQQAGLTSVQSGMDNVRNITGSPVAGLDADELIDTRGLVRKVQDMITNNSQGNPAFTNL
PRKFNIAIAGGRDNSVHAEINDIAFVPAYKDGKLGFNVLVGGFFSAKRCAPAISMNVWVD
HTQVVDISEAILIVYRDNGSRANRHQSRMMWLIDDWGVERFRAAVETQMGVTLQAAADKD
EFDWDKRDHLGVHAQKQPGLNFVGIHVPVGRFYANDMLELARMAEVYGSGEIRLTVEQNV
IIPNIPDSRLESFLAEPLLEVFSINPDPLARALVSCTGNQFCKFALIETKNRAVALIDEL
EDELDVPKPVRFHWTGCPNSCGQPQVADIGLMGTKTRKDGKTVEAVDLFMGGKVGKDAVL
GEKVQKAIPCDELKDVLKDILIQQFDAQPRSTPRSPKGTARLARQRTVQDTVSPNGFAAP
ASVTPAAPPAPTPAAAAQPAVVTFAASGKEVNCDDSQSLLEIAEAAGVEIESSCQSGSCG
TCMVKLIEGEFRYEADPDGLEDADAASGHILTCIAYPVGKVVLDA
Download sequence
Identical sequences B0CCF1
gi|158336122|ref|YP_001517296.1| 329726.AM1_2984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]