SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158336223|ref|YP_001517397.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336223|ref|YP_001517397.1|
Domain Number 1 Region: 372-571
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.33e-65
Family Pyruvate oxidase and decarboxylase PP module 0.00001
Further Details:      
 
Domain Number 2 Region: 190-364
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.9e-64
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000286
Further Details:      
 
Domain Number 3 Region: 2-178
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.6e-63
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000427
Further Details:      
 
Weak hits

Sequence:  gi|158336223|ref|YP_001517397.1|
Domain Number - Region: 570-602
Classification Level Classification E-value
Superfamily YfgJ-like 0.0602
Family YfgJ-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158336223|ref|YP_001517397.1|
Sequence length 602
Comment acetolactate synthase 3 catalytic subunit [Acaryochloris marina MBIC11017]
Sequence
MRATGAFALIDSLKNHGVKHIFGYPGGAILPIYDEVYKAEQRGDLKHILVRHEQGASHAA
DGYARATGQVGICFGTSGPGATNLVTGIATAHMDSIPMVVITGQVPRTNIGSDAFQETDI
FGITLPLVKHSYVVRDPADMARVVAEAFHIAGTGRPGPVLIDVPKDVGLQEFDYTPVQPG
TISLKGYRPTVKGNPRQIKQALDLIRQAKSPLLYVGGGAISSGAHAELKELAEWFHIPVT
TTLMGKGSFDEAHPLSVGMLGMHGTAYANFAVSECDLLIAVGARFDDRVTGKLDEFASRA
KVIHIDIDPAEVGKNRAPTVPIVGSVKPVLVELLKIAKQSSPPDTAQTQEWRSRVERWQR
DYPLMVPRPDTKLSPQEVIVELQRQAPHAYYTTDVGQHQMWAAQFLKNGPRQWVTSGGLG
TMGYGLPAAMGVQVALPDHQVICISGDASFQMNLQELATLAQYGIKVKTVIINNFWQGMV
RQWQQAFFGERYSNSSMEAGMPNFEKLAEAFGVKGGILRERNDLESVIAEMLAFDGPYLL
DAQVTRDENCYPMVAPGKSNAQMLGLPDQKTLEKAAELIYCSNCGAKNTSTNHFCPECGT
KL
Download sequence
Identical sequences B0CDL2
329726.AM1_3085 gi|158336223|ref|YP_001517397.1| WP_012163511.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]