SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158336445|ref|YP_001517619.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336445|ref|YP_001517619.1|
Domain Number 1 Region: 474-648
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.36e-44
Family Pyruvate oxidase and decarboxylase PP module 0.00075
Further Details:      
 
Domain Number 2 Region: 111-291
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.98e-42
Family Pyruvate oxidase and decarboxylase Pyr module 0.00018
Further Details:      
 
Domain Number 3 Region: 299-466
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.69e-41
Family Pyruvate oxidase and decarboxylase, middle domain 0.001
Further Details:      
 
Domain Number 4 Region: 6-108
Classification Level Classification E-value
Superfamily ISP domain 8.38e-28
Family Rieske iron-sulfur protein (ISP) 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158336445|ref|YP_001517619.1|
Sequence length 650
Comment thiamine pyrophosphate enzyme [Acaryochloris marina MBIC11017]
Sequence
MPEITPQWFRVLDLDELPEGRVKTVVAGHKSLALTHHQGQYGALDNRCPHQGGPLGEGSI
ENGLLRCPWHGWDYCPLTGQPPGGLDVDDALETFPVEVRDDGVYVGLPVEKPHIRTVSDV
MAETMVNWGVTHVFGMVGHSNLGLADTLRRQEEQGKLTYIGIRHEGAAAFAASAYAKLTG
TPAACLTIAGPGATNLLTGMWDAKVDCAPILALTGQVNSQVLGTGNFQECDLSAAFSGVA
AWSQTVLSHSKHAELMTLAIKHALLERNVSHLIFPDEIQVQPAVDVPAATPTGRITPLQI
APPPESLQQAIGKLKQSRRPVIIVGHGARFHMPAVIELAELLGAPVLTTFKGKGQIADDH
PLGCGVLGRSGTPIASWFMNEADVLLVLGASFSNHTGIYPGKPIIQVDFDPLALGKFHPI
EVPVWGEISIVVEQLKTALSMQVDTEDVQSEIAERWAIWRAEKARRELDDRGQGLNSAAI
FAAMTRWVPAHAVIAVDVGNNTYSFGRYFECQAQSVLMSGYLGSIGFAFPAAMGAWAAAG
HKRPIVSVSGDGGFGQYLAEFTTAVKYQMNITHILLHNDQLGKISKEQRAGEWDVWQTSL
HNPDFSQYAQNCGGFGIRVTQPDELDDAMAQALAYQGPALVEIMSDPELI
Download sequence
Identical sequences B0BZ03
WP_012163709.1.67183 gi|158336445|ref|YP_001517619.1| 329726.AM1_3309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]