SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158336591|ref|YP_001517765.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336591|ref|YP_001517765.1|
Domain Number 1 Region: 289-518
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.1e-45
Family ABC transporter ATPase domain-like 0.0000805
Further Details:      
 
Domain Number 2 Region: 66-283
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 8.89e-21
Family DNA repair protein MutS, domain III 0.032
Further Details:      
 
Domain Number 3 Region: 720-790
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000288
Family Smr domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|158336591|ref|YP_001517765.1|
Domain Number - Region: 524-602
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0445
Family Apolipoprotein 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158336591|ref|YP_001517765.1|
Sequence length 794
Comment recombination and DNA strand exchange inhibitor protein [Acaryochloris marina MBIC11017]
Sequence
MIVEKTLELLEWERLCQHLSTFAATKLGVAAAIELPIPDTVEASETLLQQTQEVYDLETQ
LLTALTFEGIHDIRAALVRSQRQGILRGEELLQVATTLLGSRNLRRLINRYPELTSLNQL
VADLRTYPELEQEIRHCIDEQGEVADRASEKLMGIRERQRQVRNDVQTILQRILQRKGAA
LQERLITQRSNRFVVPVKAPQKDAVPGIVHDASTSGATLYIEPKATVELNNRLRQLTRQE
QAEAEAIRQALTEKVAEVHEDLDALLQIVTLVDLATARARYSYWLEANRPRFVNRAADTL
TLRRLRHPLLVWQQQHEQGPEVVAIDVTIQPQIRVVAITGPNTGGKTVTLKTLGLATLMA
KVGLFVPAQEPVELPWFDQVLADIGDEQSLQQSLSTFSGHIRRIQEIIAALTDQSLVLLD
EVGAGTDPLEGSALAIALLRYLADQAQLTIATTHFGELKALKYTDNRFENASVEFDDATL
QPTYRLLWGIPGRSNALIIAQRLGLNEQVIAQAQAQMDGETDDVNQVIAGLETERRQQET
KAQAAAQLLQSTEQLHEQVAKKASDLKVREQKLRQQQEKAIQEEIRRAKQAIAQVIRDLQ
QQPKSAPAAQVATERLEKIANQRLPSRTKPKAPPPKGFQPQVGDRVRIPSIGQKADVIKI
TPTNELVVKFGMMKMTVKPTEIESLTGEKVAPPPKKTDSAPKKGDNTPKNSAPMVRTSKN
TLDIRGSRVADAEVVIEDAIAKAQGPLWIIHGHGTGKLRQGVQAYLSQHPLVSRYEFAEQ
ADGGKGVTIAYCGV
Download sequence
Identical sequences B0C151
gi|158336591|ref|YP_001517765.1| WP_012163847.1.67183 329726.AM1_3455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]