SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158336764|ref|YP_001517938.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336764|ref|YP_001517938.1|
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily L21p-like 2.88e-34
Family Ribosomal protein L21p 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158336764|ref|YP_001517938.1|
Sequence length 136
Comment 50S ribosomal protein L21 [Acaryochloris marina MBIC11017]
Sequence
MTFAIIETGGKQLKVEPGRYYDVDRLADDPDTKLSLNQVLLVHDGNEATVGQPLVKGATV
EVTVMQHRRDRKIIVYKMQPKKKTRKKRGHRQELTRLMVDAIHLDGKALGAASTKKTKKS
KASDEAVAVEAEVVAD
Download sequence
Identical sequences B0C3C3
329726.AM1_3632 WP_012164012.1.67183 gi|158336764|ref|YP_001517938.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]