SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158336925|ref|YP_001518100.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336925|ref|YP_001518100.1|
Domain Number 1 Region: 222-461
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.17e-70
Family Leukotriene A4 hydrolase catalytic domain 0.001
Further Details:      
 
Domain Number 2 Region: 22-213
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 8.76e-49
Family Leukotriene A4 hydrolase N-terminal domain 0.0006
Further Details:      
 
Domain Number 3 Region: 557-848
Classification Level Classification E-value
Superfamily ARM repeat 3.93e-21
Family PBS lyase HEAT-like repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158336925|ref|YP_001518100.1|
Sequence length 868
Comment peptidase M1, membrane alanine aminopeptidase [Acaryochloris marina MBIC11017]
Sequence
MSHLFFDSETKKHKSFEMAGARPHYNPDRPGQVEHIFLDLTLDIPGQSFGGTCQIRLNPV
RSGIKTLVLDAVDLQIEGVKVGRAKQPFDYDGEQLQIHLKQPTRAGKVFTVAISYAVHQP
QRGLYFVQADEHYPDKPTQVWTQGEDEDSRFWFPCFDYPGQLATSEIRVRVPKAYMAISN
GELIETEVDGKQKIYHWLQREVHPTYLMTLAVGQFAEIIDEWQGKPVTYYVEKGREDQAK
LTMGKTPRMIEFFSEYYGYPYAYPKYAQVCVDDFIFGGMENTSTTLLTDRCLLDERAAID
NRAAESLVAHELAHQWFGDLVVIKHWSHAWIKEGMASYSEVMWTNHEYGAEDAAYYRLRE
ARNYFNEDSTRYRRPVVTHVYREAIELYDRHLYEKGACIYHMIRAELGDELFWRAIHTFV
QDNAHQTVETIDLLRAIEKATGRNLLFLFDQYVYRGGHPEYKLGYSWDADHQMAKVTVTQ
TQVDPKDKNSAKELFDLNLPIAFGYDRGKQPVEFQTFTVRVHEQEQSFYFGLPEKPLFIS
FDQGNHYLKQVSLEYPMPELKAQLKQDPDPLSRIYATQSLAKKGGLEVVKSLGEALTTDG
FWGVRVEVAKQLAQIKLDQVLPALKPGLKDQDARVRRAVVEAMATFKTDESYKAIKPLAE
KGDPSYYVEASALRAVGAIAASTLTTKPKETKVIKLFKSVLKGRAGWNEVVRSGAIGALS
QMKTSTAALDLILAYSEAGTPQPLRLAAIRALGSISTGQSPEQLQRILDRLSVLVGESFF
LTQVSVSASLGQMETPNAIALLKTLANQTPDGRVRRMAEESIKKVQARVKSNQALSTLQE
EVQQLQQANQELKSRLADLEAKSKPSEA
Download sequence
Identical sequences B0C5R2
329726.AM1_3796 gi|158336925|ref|YP_001518100.1| WP_012164158.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]