SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158336981|ref|YP_001518156.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336981|ref|YP_001518156.1|
Domain Number 1 Region: 119-269
Classification Level Classification E-value
Superfamily alpha/beta knot 3.01e-35
Family SpoU-like RNA 2'-O ribose methyltransferase 0.0004
Further Details:      
 
Domain Number 2 Region: 18-110
Classification Level Classification E-value
Superfamily L30e-like 0.000000000214
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158336981|ref|YP_001518156.1|
Sequence length 279
Comment RNA methyltransferase [Acaryochloris marina MBIC11017]
Sequence
MVSRKSADCSASSVAATLHRIKRLQTDRRYRDAQGACFIEGVRNFVHVSDSRLDIAVIVY
SEKLLTAPLARKLVRRFRRSGVETISVSPEQFRGISQTHRASGIGAIIRQRWQRLPSITP
SMGLWVILDRVRSLGNFGTLIRTLDAGGGTGFILLNQAVDPYAPSTVRASMGSVFQQQFI
RTHDQALSQWLQQHQGYVIGASPDGEENFHTFTYPKNTLLFLGEERTGLSPKQRSLCNTL
LKIPMVGQVDSLNVAVAGSLFIYEVLRSRMLDSSDFRGN
Download sequence
Identical sequences B0C700
329726.AM1_3854 gi|158336981|ref|YP_001518156.1| WP_012164207.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]