SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158337091|ref|YP_001518266.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337091|ref|YP_001518266.1|
Domain Number 1 Region: 61-128,181-250
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 6.41e-29
Family Ribosomal protein S4 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158337091|ref|YP_001518266.1|
Sequence length 259
Comment S4-like domain-containing protein [Acaryochloris marina MBIC11017]
Sequence
MLPKAKLLNGVEHTDCMSRLLDQATQALKTWEVVVSAFLSPPELAEAQQMFAPLTEVSIL
AWGGYPQAERQRIAIAHSDLPLDQSQVELAALSISGNFLFDPASHRDFLGALLGTGIVRD
QVGDILVLGERGAQAIASPQLVPFLQTHLTQVRTVPVQVEPIPFEQLKVREPRCKEMTTV
EASMRLDAVASAGFGLSRSKMVNLINTGDVRVNWKEISQSSYGLKTGDLVTIRGKGRLEL
GEVQITKKERYRIQLKRFS
Download sequence
Identical sequences B0C8C9
gi|158337091|ref|YP_001518266.1| WP_012164305.1.67183 329726.AM1_3964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]