SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158337105|ref|YP_001518280.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337105|ref|YP_001518280.1|
Domain Number 1 Region: 143-419
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.58e-125
Family Enolase 0.0000000412
Further Details:      
 
Domain Number 2 Region: 5-140
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.9e-54
Family Enolase N-terminal domain-like 0.00000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158337105|ref|YP_001518280.1|
Sequence length 426
Comment enolase [Acaryochloris marina MBIC11017]
Sequence
MHETEIAAIEAREILDSRGRPTVEAEVILSCGAFGLAQVPSGASTGSFEAHELRDGDAQR
YGGKGVLTAVTNIKDHIQPELVGLNALDQADIDQTMIDLDGSTNKSKLGANAILAVSLAT
AKAASEVLNLELYRYLGGPLANLLPVPLMNVINGGAHANNNVDIQEFMIVPHGADSFKEA
LRWGAEVFASLSQVLAAQNLLTGVGDEGGYAPNLASNQAALELLVEAIEKAGYQPGAQIS
LALDVAASEFYKDGQYTYDGAAHSPKELIDYLDGLASKYPIVSIEDPLHEEDWESWGNLT
AQLGDRVQLVGDDLFVTNPIRLQKGIEQQSANSILIKLNQIGTLTETLETIDLAKRNSFT
SIISHRSGETEDTTIADLAVATRAGQIKTGSLCRSERVAKYNRLLRIEDELGSQASYAGA
VGLGPG
Download sequence
Identical sequences B0C9F0
329726.AM1_3978 gi|158337105|ref|YP_001518280.1| WP_012164319.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]