SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158337167|ref|YP_001518342.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158337167|ref|YP_001518342.1|
Domain Number - Region: 320-369
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0491
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number - Region: 141-251
Classification Level Classification E-value
Superfamily ADC synthase 0.0794
Family ADC synthase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158337167|ref|YP_001518342.1|
Sequence length 383
Comment YjgP/YjgQ family membrane protein [Acaryochloris marina MBIC11017]
Sequence
MALAQIKRSRKLRKFRISRLDRFILRAFWMPWVFAFGAFTTISFSIGALFDTLRRLTEGT
LSSVDALQVLVLQLPRFMVLALPMSMLLAPLLTYSQLARKNELIALKACGTSVYRVIRPA
LCFSLIVAVSTLTLNEWIVPPATAAVHRLQAQQTVSQITAIPRQNIVHQTYHHQRLTQLF
HARAFDGEALHQLTILQFQDRHLHHIWLAKQAIWDSTHQQWILSQGTRYTIDPVSGLYQQ
VVPFKRHPFHQVSPQELAEVAHQPISLHETQALIQQIKQSGNLPTLQRLQVRWHALMAFP
WIGVGFTLMGSSLGCQSTSKQGSLGFGLSSLLIFGYYTFSFICQTLGDAGIWSASIAGWL
PIVVLLTIGSALLHHNNTYSKRF
Download sequence
Identical sequences B0C9L2
gi|158337167|ref|YP_001518342.1| 329726.AM1_4043 WP_012164379.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]