SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158337186|ref|YP_001518361.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337186|ref|YP_001518361.1|
Domain Number 1 Region: 98-203
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000736
Family HtrA-like serine proteases 0.014
Further Details:      
 
Weak hits

Sequence:  gi|158337186|ref|YP_001518361.1|
Domain Number - Region: 17-106
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.0209
Family FtsH protease domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158337186|ref|YP_001518361.1|
Sequence length 362
Comment membrane-associated zinc metalloprotease [Acaryochloris marina MBIC11017]
Sequence
MPPFAGIFIMIGILGLLIAVHELGHFLAARLQGIHVNRFSIGFGPVLWKYQGEQTEYALR
SIPLGGYVGFPDEDPESSIPLTDPDLMRNRPVLDRAIVISAGVIANMILAYVLLVAEVGI
VGVPGGVQYQPGVLIAQVATDVSSVAANAGIQSRDIVLAVDGQPLGQAEAARDSLMKSIQ
DNDGQPIQLHIKRQDQELDISIIPERTDEGLARIGVQLAPNGRLVRRPIQHVGELFGTAA
QEFQKIVGFMAHTLSELVGNFRESASQVAGPVGIVAIGADMARTDMSSLFQFAAVISVNL
AFINILPLPALDGGQLAFLLLEGLRGKPLPNKIQEGVMQVSLFLLLGLGVFMIVLDTAKL
MT
Download sequence
Identical sequences B0CAH8
WP_012164395.1.67183 gi|158337186|ref|YP_001518361.1| 329726.AM1_4063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]