SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158337192|ref|YP_001518367.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337192|ref|YP_001518367.1|
Domain Number 1 Region: 4-327
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.78e-93
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000484
Further Details:      
 
Domain Number 2 Region: 368-502
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.31e-29
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158337192|ref|YP_001518367.1|
Sequence length 504
Comment cysteinyl-tRNA synthetase [Acaryochloris marina MBIC11017]
Sequence
MPLQIYNTLSRTKEPFTTLEAGKVQFYCCGVTVYDYCHLGHARSYIVWDIVRRYLQWRGY
DVTYVQNYTDIDDKILKRAAETGQDWQAVTQTFIQAYEADMARLNILAADAYPKATESIP
AIINLIRDLETRGVAYAAQGDVYFAVERFPGYGKLSGRLLDQMEAGASGRVEQLEPAEQK
KRHPLDFALWKATKPGEPSWDSPWGPGRPGWHIECSAMVNQCLGAEIDIHAGGSDLVFPH
HENEIAQSEAGLTPRLARYWMHNGFVNVGGEKMSKSLGNFTTIRQLLDTPLPILAGKTLH
PMALRLFVLQAQYRKPIDFTDDAIAAAQQSWQTLKEGLLFGYDYGAQLQWSDYTDPDFGN
PANMRIPDPNVAVQRFQLAMDDDFNSPSGLVVLFELAKDLRKAGNILSHQGETSTTSEQL
REQWQTLVCLAQVLGLEAQPDSDAASTDSEDGLSEQAIEALIEERQAARQAKNYAESDRI
RDQLKAEGITLIDQAGGVTRWLRE
Download sequence
Identical sequences B0CAI4
gi|158337192|ref|YP_001518367.1| 329726.AM1_4070 WP_012164400.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]