SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158337356|ref|YP_001518531.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337356|ref|YP_001518531.1|
Domain Number 1 Region: 174-397
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 9.42e-93
Family Argininosuccinate synthetase, C-terminal domain 0.000000886
Further Details:      
 
Domain Number 2 Region: 5-205
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.08e-43
Family N-type ATP pyrophosphatases 0.0000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158337356|ref|YP_001518531.1|
Sequence length 399
Comment argininosuccinate synthase [Acaryochloris marina MBIC11017]
Sequence
MGRAKKVVLAYSGGVDTSVCIPYLKHEWGVEEVITLAADLGQGDELEPIRKKALDAGAAQ
SLIADGTESFIADYAFPAIQANALYENRYPLSTALARPLIAKLLVEAAEIHGADAVAHGC
TGKGNDQVRFDVSITALNPDIKVLAPAREWGMSREETIAYGEKYGVQSPVKKSSPYSIDR
NLLGRSVEAGPLEDPWVEPLEEVYDLTKAIADTPDQPEYVDIDFAQGLPTQLNGQALSPV
ALVEQLNQIVGNHGVGRIDMVENRLVGIKSREIYEAPALLVLIQAHRELESLALTADVTH
YKRGIEETYSQLVYNGLWFSPLKDALDAFIQQTQKQVTGTVRVKLFKGAATVVGRQSPHS
LYTPDLATYGAEDAFDHKAAEGFIYVWGLPTRVWSQQQR
Download sequence
Identical sequences B0CCQ2
WP_012164545.1.67183 329726.AM1_4234 gi|158337356|ref|YP_001518531.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]