SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158337540|ref|YP_001518715.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337540|ref|YP_001518715.1|
Domain Number 1 Region: 117-299,434-589
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.59e-104
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000783
Further Details:      
 
Domain Number 2 Region: 296-429
Classification Level Classification E-value
Superfamily GAD domain-like 5.07e-33
Family GAD domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.9e-33
Family Anticodon-binding domain 0.0000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158337540|ref|YP_001518715.1|
Sequence length 595
Comment aspartyl-tRNA synthetase [Acaryochloris marina MBIC11017]
Sequence
MRTHYCSELRNDHVGERVTLCGWVDRRRDHGGVIFLDVRDRTGLIQIVSDPERTPEAYPQ
ADALRNEYVVRIHGEVSRRPDDSLNPRLPTGEVEIYADQIELLNAVHQQLPFQVSTADVE
SVKEELRLKYRYLDLRRDRMHQNIMMRHRLIQSIRRYLEDQQNFVDIETPVLTRSTPEGA
RDYLVPSRANPGEWFALPQSPQIFKQLLMVSGFDRYYQIARCFRDEDLRADRQPEFTQLD
MEMSFMSQEEIIQLNEDLMRHVFKTLKDIDLPKTFPQMTYAEAMERFGTDRPDTRFDLEL
VNVSDLLEDSGFKVFSGAIKKGGQVKVLPIPDGNAKISNVRIKPGGDLFSEASAGGAKGL
AYIRVKDDGAIDTIGAIKDNLSPEQTAELLERTGAKPGHLLLFGAGPTEIVNASLSRLRL
ALGAEMKLIDPDQIDLLWITEFPMFEWNADEKRLEALHHPFTAPYPEDEADLKTARAQAY
DLVYNGLEIGGGSLRIYQADLQRRVFDAIGLSEEEAQDKFGFLLNAFNFGAPPHGGIAYG
IDRLAMLLSGEESIRDTIAFPKTQQARCLLTQAPSSVDQKQLKELQIKSTAEPKN
Download sequence
Identical sequences B0CF01
WP_012164720.1.67183 gi|158337540|ref|YP_001518715.1| 329726.AM1_4421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]