SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158337547|ref|YP_001518722.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337547|ref|YP_001518722.1|
Domain Number 1 Region: 25-247
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.67e-55
Family Class I glutamine amidotransferases (GAT) 0.00000724
Further Details:      
 
Domain Number 2 Region: 207-434
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.18e-52
Family N-type ATP pyrophosphatases 0.00000186
Further Details:      
 
Domain Number 3 Region: 421-541
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.57e-51
Family GMP synthetase C-terminal dimerisation domain 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158337547|ref|YP_001518722.1|
Sequence length 541
Comment GMP synthase [Acaryochloris marina MBIC11017]
Sequence
MPSQTQQPLSAHPQDSTFAQTPVDRQMIVILDFGSQYSELIARRIRETQVYSEVLSYRTS
IEQLRQLNPKGIILSGGPNSVYAQHAPACDPEIWNLGIPVLGVCYGMQLMVQQLGGQVEA
SDAAEYGKASLIIDDPTDLLTNVEDQTTMWMSHGDSVTALPEGFKVLAHTANTPQAAVAH
HDRQLYGVQFHPEVVHSQGGQALICNFVYHICECEPTWTTEAFVEEAIREVRAKVGNKRV
LLALSGGVDSSTLAFLLHKAIGDNLTCMFIDQGFMRKLEPERLIKLFRDQFHIPVEYVMA
RDRFLERLNGITDPEEKRKRIGHEFIQVFEEESRRLGPFDYLAQGTLYPDVIESADTNVD
PATGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRSLGLPEEIVNRHPFP
GPGLAIRIIGEVTAERLNILRDADLIVRQEVNRSGNYSEFWQAFAVLLPVRSVGVMGDQR
TYAYPVVLRFVSSEDGMTADWSRAPYELLETISNRIVNEVKGVNRVAYDITSKPPGTIEW
E
Download sequence
Identical sequences B0CF08
329726.AM1_4428 gi|158337547|ref|YP_001518722.1| WP_012164727.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]