SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158337554|ref|YP_001518729.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337554|ref|YP_001518729.1|
Domain Number 1 Region: 683-867
Classification Level Classification E-value
Superfamily beta-Roll 3.23e-26
Family Serralysin-like metalloprotease, C-terminal domain 0.00087
Further Details:      
 
Domain Number 2 Region: 447-576
Classification Level Classification E-value
Superfamily beta-Roll 1.05e-24
Family Serralysin-like metalloprotease, C-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 552-678
Classification Level Classification E-value
Superfamily beta-Roll 1.02e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.00094
Further Details:      
 
Domain Number 4 Region: 341-466
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000994
Family Serralysin-like metalloprotease, C-terminal domain 0.0016
Further Details:      
 
Domain Number 5 Region: 140-195
Classification Level Classification E-value
Superfamily PKD domain 0.00000615
Family PKD domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158337554|ref|YP_001518729.1|
Sequence length 909
Comment hemolysin-type calcium-binding protein [Acaryochloris marina MBIC11017]
Sequence
MIIGNPDQPRGRGIFENHASFNINFNKLRVKGFNEGFKIEFPNHHQDFIASSLNNSYFSR
NKYNISAIGGAPLGNGTRPDDFPKNLKINNTRFIGAGNNALPVALFNSKTIGGLALAFDA
GASYDTDPLKPDGQGLTRALASNAIAAYGWDFNNDGKIDKFGRQVSHQFSQAVTLTVWDN
QGATHTLTKTFNVQRANYLNPFQNNDFRSGTAFGAAYRGNSAGADLSWLATPGVRRNASI
GNGAAVLSSPNHYGTGLAQVIYDQHIRRGMQTLGLKLKNTEESGKLNNDIDITLWGVNGQ
FENSLYLTSGPQRAGTLPMQRVKLADVTLGGTNFDWQSFRWNVDLKQGYDFLLFQVNTRG
TKDQGDFVGLDDVRLFGNGISTPTPSPIPSGDNHFFLDGTDANNWMRGSDRNQYMEGRGG
NDTLRGAGGNDSLYGGTGNDHLHGEVGNDDLYGGDGNDLLDGGTGDDKFNGGNDNDTLVG
QDGNDNLNGGAGLDVLYGGDGDDTLNGGAGNDSLWGSSGNDRLYGLEGDDRLDGALGDDN
LNGGEGNDTLAGGEGNDTLYGDIGQDRLLGADGNDTLNGAAGDDELRGDGGDDSLYGDVG
NDSLYGGSGSDTLSGGNDADSLMGGNGNDHLNGGDGQDQLFGNSGDDTLFGGRGDDQLLS
SWGNDTLYGALGNDTLEGDYGEDSLYGYEGDDLIRGGMGRDRLYGEAGNDALWGGSGDDY
LAGGLGNDSHWGEDGNDQIWAAAGNDLIYGGKGQDSLGGGAGNDSLHGGDGNDLLSSQDG
NDWLMGDAGNDTLRGEGGNDTLTGGRGNDSVEGGHGNDLLMGVDATQTQAGRGEQDILTA
WTGINTFVLGDASQAFYNDGQNNTLGAEDYALSKDSSNLVGIKFNSTDKPLTIGWGQLRR
VCNQEQPFS
Download sequence
Identical sequences B0CF15
gi|158337554|ref|YP_001518729.1| WP_012164732.1.67183 329726.AM1_4435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]