SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158337679|ref|YP_001518855.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337679|ref|YP_001518855.1|
Domain Number 1 Region: 4-191
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.61e-40
Family Phosphoglucomutase, first 3 domains 0.0015
Further Details:      
 
Domain Number 2 Region: 259-391
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 8.63e-28
Family Phosphoglucomutase, first 3 domains 0.0013
Further Details:      
 
Domain Number 3 Region: 161-273
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 6.67e-24
Family Phosphoglucomutase, first 3 domains 0.0014
Further Details:      
 
Domain Number 4 Region: 392-480
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 8.76e-21
Family Phosphoglucomutase, C-terminal domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158337679|ref|YP_001518855.1|
Sequence length 482
Comment phosphoglucomutase/phosphomannomutase family protein [Acaryochloris marina MBIC11017]
Sequence
MPNDFASSIKFGTDGWRGIIAKDFTFERLVYVAPIAAQILEKTYGSPDKKHLVIVGYDRR
FLSEEFAQATAETVQQAGFDVLLSDTFAPTPAFSWAAYHRQALGALVITASHNPGIYSGL
KVKGAFGGSVPPAVTQAIQDRLVTAPVKAATAGTLDTFDPWPDYCQVLQSKVDMEVINQA
IHQKRLTVFVDTMHGATATGLQRLLSAEITELNCDRDPLFEGGAPEPLPKYLGKSIQAIQ
SHRQQAPQEEAIVGFVFDGDGDRIAAMDGQGNFLSSQILIPILIEHLAARRKFQGEVIKT
ISGSELIPQVADLYQLPLHETPIGYKYIADYMLAAESVLIGGEESGGIGYGNHIPERDGL
LSALYLLEAAAQTGQDLSHLYQQLQTQTGFTSFYDRIDLPLSSEADKQKLIDQLQTAPFS
QVLDQKVVDVLSIDGFKFSLADQSWLLVRFSGTEPVLRLYCESHHPDRVSKILAWAKDWA
LR
Download sequence
Identical sequences B0BZ93
329726.AM1_4563 WP_012164846.1.67183 gi|158337679|ref|YP_001518855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]