SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158337695|ref|YP_001518871.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337695|ref|YP_001518871.1|
Domain Number 1 Region: 212-325
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 1.57e-33
Family DRTGG domain 0.00027
Further Details:      
 
Domain Number 2 Region: 6-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.76e-29
Family Nitrogenase iron protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158337695|ref|YP_001518871.1|
Sequence length 362
Comment DRTGG domain-containing protein [Acaryochloris marina MBIC11017]
Sequence
MQKASKHLLIGSIEAFSGKSAAILGLAQSLISKGYRLAYAKPIGTYAEGLANDGLDIDVK
FIAETLGLTSEQIYPTLLSINPHHIQQQLEDRDATNYVEQLHQLEKRDDVDLVLLEGPGS
LSEGYLFDVSLPQMAQALDAEVVLVSRFHNLAMIDALLNAKAILGNRLVGVIFNDVNVEQ
QQLLQSTVQSFLETKEIPVVGILPSNALLRSVSVSELVQQLQAEVLCGHEFLNLMVEELT
IGAMNVNSALKYFRKGRNMAVVTGGDRTDLQLAALESSTHCLILTGHFPPNELVLNRAKD
LEIPVLLVDSDTLTTVDIIEKAFQRAQVHERIKVECIQDMISQYCDIDRLLSALGLPSPV
AL
Download sequence
Identical sequences B0BZA9
gi|158337695|ref|YP_001518871.1| 329726.AM1_4579 WP_012164859.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]