SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158337816|ref|YP_001518992.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337816|ref|YP_001518992.1|
Domain Number 1 Region: 112-208
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 3.66e-37
Family Ribosomal protein S3 C-terminal domain 0.0000198
Further Details:      
 
Domain Number 2 Region: 2-108
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 3.66e-34
Family Prokaryotic type KH domain (KH-domain type II) 0.000076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158337816|ref|YP_001518992.1|
Sequence length 241
Comment 30S ribosomal protein S3 [Acaryochloris marina MBIC11017]
Sequence
MGQKIHPTGFRLGITQDHWSRWFADTDRYPELLQEDFKVRNYVNKNLSNAGIAGVRIERK
ADQIDLEVRTARPGVVVGRGGSGIESLRVGLQKELGDDRPIRINVVEVARVDAEATLIAE
YIVQQLVRRVSFRRVVRQAIQRAQRAGVEGIKIQVGGRLNGAEIARSEWTREGRVPLHTL
RANIDYSYRTASTTYGILGVKVWVFKGEVIPGADEQPTNREPQQRRRQQQRRRQQFEDRS
E
Download sequence
Identical sequences B0C1D9
WP_010469315.1.53659 WP_010469315.1.67183 gi|158337816|ref|YP_001518992.1| 329726.AM1_4702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]