SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158338060|ref|YP_001519236.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338060|ref|YP_001519236.1|
Domain Number 1 Region: 41-174
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.09e-34
Family Pentapeptide repeats 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158338060|ref|YP_001519236.1|
Sequence length 184
Comment pentapeptide repeat-containing protein [Acaryochloris marina MBIC11017]
Sequence
MAVLWFGAIPPDLAHAQMRMGPLSKEAIKNVPALRQTKICEGCDLAGANLRSFELQNGNL
KNADLTNSTIQFSDLTNATLEGANLSSSRIEDTIVTGANFSKADLSVSNLNGCDFSGVNL
QGAILRAATLNKTNFANADLRGAMLRAANLNGANLEGANLEGANLCNTVMPDGTLSFRNC
RPPE
Download sequence
Identical sequences B0C4N5
gi|158338060|ref|YP_001519236.1| 329726.AM1_4947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]