SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338076|ref|YP_001519252.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338076|ref|YP_001519252.1|
Domain Number 1 Region: 4-74
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.000000228
Family GSPII protein E N-terminal domain-like 0.033
Further Details:      
 
Domain Number 2 Region: 70-137
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000942
Family GSPII protein E N-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158338076|ref|YP_001519252.1|
Sequence length 650
Comment hypothetical protein AM1_4963 [Acaryochloris marina MBIC11017]
Sequence
MPSASTKPLGAVLQQAGLISVAQVSLALQEQTINQHRLGDLLCEHGWLKEPTADFFAEQW
PTLFHDPDPLPLEQYLRQAHLLTDTQIDYLLEQQNLTQLKFGVLAVANGWIKLQTINFFL
THLQGTPQSQPSETDQAINFDTPEYWQHQREYLLENELANPYSLLQIYEQILTHYDIPFT
GDLEQTALLNLGLVTLRHNRLIIAHPLFRSVFNAEWIQRERNRLHPYDKIRLQFLNLSKA
GAYPYRLLEAILTWTNNHSVLNQKVAHLVRTSSFVEAGEESVVVEQLVQSQIIHNWRSGF
ATKHLSSIEEQVLQNPNCDPIDLLTYYQVVWHQLQAPSIQGEEEAELLRLGLLIQDGQQV
KVANQIYRLVFDQTWLEQHISHILNPLPLDKEDSTPAATVPEEVPLHSEHLSGVKHSVGP
IRRSWKLIGILLLSGLGIGSAIWAVSRHRQLQTELASSPEQDVQIPANQPSISPESPVPS
TQIEERPSASPKSTPTPIESTPPNASGGVVLLAENSRVPVFSVGVTDTDIQAALGPPTLK
SPGYWPNSYGLLYKNLHPHQADFGFLLDADTQRLRQTEAAFAQSAGLDTLRLALQGMLKD
RPPVEVMEQLTLIYQRQAREYEFQVGELKGIIQRNEKDRIYIGVWDADFH
Download sequence
Identical sequences B0C4Q1
329726.AM1_4963 WP_012165207.1.67183 gi|158338076|ref|YP_001519252.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]