SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338084|ref|YP_001519260.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338084|ref|YP_001519260.1|
Domain Number 1 Region: 4-244
Classification Level Classification E-value
Superfamily Hsp33 domain 4.71e-68
Family Hsp33 domain 0.00000463
Further Details:      
 
Domain Number 2 Region: 233-292
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 1.23e-19
Family HSP33 redox switch-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158338084|ref|YP_001519260.1|
Sequence length 299
Comment Hsp33-like chaperonin [Acaryochloris marina MBIC11017]
Sequence
MADQLIRATAADDGIRAVGVITTRLTEDARQRHGLSYVATAALGRTMSAGLLLASSMKQA
EARINLRIRGDGPLQGILVDAGLDGTVRGYVTNPGVELPPNAKGKLDVGGAVGKGFLYVI
RDMGYGYPYSSTVELVSGEIGEDVTHYLVTSEQTPSALALGVFVGAQGVTASGGLLIQVL
PKAAEDPALVELLESRLAHLQGFTPLLQAGKTLPDIFTDLLGDMGLKIFPQTQMVQFQCR
CSTERVLGALKMLGQDELLDMIEKDDGAEATCDFCGEVYQVTSDQLGKLIDDLKTEAGA
Download sequence
Identical sequences B0C4Q9
WP_012165215.1.67183 329726.AM1_4974 gi|158338084|ref|YP_001519260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]