SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338163|ref|YP_001519340.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338163|ref|YP_001519340.1|
Domain Number 1 Region: 47-303
Classification Level Classification E-value
Superfamily PP2C-like 2.35e-46
Family PP2C-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158338163|ref|YP_001519340.1|
Sequence length 306
Comment protein phosphatase 2C [Acaryochloris marina MBIC11017]
Sequence
MKYDHQLLTDPQTSAPKTGGIAYQEALKKWSERPTQLLSPSQSLLSLESVGRTDVGLNRS
HNEDYFSIDQQHFCTPDLPDGGYRGLYILCDGMGGMARGEVASELATKTLRSYLNSRWQR
HLPTEIGLELAINTANKAVYERNQREQRAGSGRMGTTAVVVMVNNTHIRYVHIGDSRLYR
LTRQYGLQQLTTDHNAYQRALQRGYSPEEAQAFGPQLTKALGPWSGESLRPKSQTLAVEE
DTVFLLCSDGLSDHDLLENHANSHLMGMLDFRTDLATGMDQLMALANQKNGHDNITAIAV
RLRPQP
Download sequence
Identical sequences B0C744
gi|158338163|ref|YP_001519340.1| WP_012165292.1.67183 329726.AM1_5055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]