SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338168|ref|YP_001519345.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338168|ref|YP_001519345.1|
Domain Number 1 Region: 179-278
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 1.31e-25
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0009
Further Details:      
 
Domain Number 2 Region: 110-173
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 8.17e-16
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0021
Further Details:      
 
Domain Number 3 Region: 24-109
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0000000432
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158338168|ref|YP_001519345.1|
Sequence length 300
Comment mechanosensitive ion channel protein [Acaryochloris marina MBIC11017]
Sequence
MSDILKTIESSLNELLASSVKVFPALLTAVIVLFLTRYMAQFAQRVVGKAGKTAFRSHSI
QILLEKTAYVMTWVIGVVFAGVLVFPGLDLGDIIATLGLGSVAIGFAFQDIIKNFFAGIL
LLLQEPFSINDQIIIDSFEGTVEKINFRTTQIRTYQGERILIPNANVFTSAVQVQTAYPS
RRTDLGVGVDYNTPLEDAASLLQDTIEQLEGVLPSPRVEIDLVGFGDSSIDFIVRYWTEP
QQAQVRRIQTKAIIVIKKAFDKADINIPYPIRTLYYYNQDNYNDYMPTNRNSNNHQLSKV
Download sequence
Identical sequences B0C749
gi|158338168|ref|YP_001519345.1| 329726.AM1_5060 WP_012165296.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]