SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338228|ref|YP_001519405.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338228|ref|YP_001519405.1|
Domain Number 1 Region: 3-212
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.08e-50
Family Phosphoglucomutase, first 3 domains 0.0000013
Further Details:      
 
Domain Number 2 Region: 410-544
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 2.27e-48
Family Phosphoglucomutase, C-terminal domain 0.0000152
Further Details:      
 
Domain Number 3 Region: 279-415
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 9.03e-38
Family Phosphoglucomutase, first 3 domains 0.0000143
Further Details:      
 
Domain Number 4 Region: 182-292
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.59e-30
Family Phosphoglucomutase, first 3 domains 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158338228|ref|YP_001519405.1|
Sequence length 544
Comment phosphoglucomutase [Acaryochloris marina MBIC11017]
Sequence
MSINTVYTQPFSDQKPGTSGLRKQVTVFQQFHYLENFIQSIFDSLDNYQGQTLVVGGDGR
FYNRHAIQVILKMAAANGFGKVLVGQNGILSTPAVSCVIRQNKAYGGIVLSASHNPGGPD
GDFGIKYNIGNGGPAPEKVTEAIYARSKEIDVYRITEADDVNLDQLGTSQLGEMTVEVID
SVQDYAQLMESLFDFDRIRQLLTSGGFSLIVDSMHAVTGPYAHALFADRLGAGADSVMNG
KPLEDFGGGHPDPNLVYAHELVEQLFGDNAPNFGAASDGDGDRNMILGQRFFVTPSDSLA
ILTANAKLVPGYQNGLAGVARSMPTSQAVDRVAAKLGFDCYETPTGWKFFGNLLDADKAT
LCGEESFGTGSNHVREKDGLWAVLFWLNILAVRQQSVESIVKEHWQEYGRNYYSRHDYEA
VDSEKANTLMANLRGKLAKLKGQKLGQYEVDYADDFSYTDPVDGSVSQKQGVRIGFTDGS
RIVFRLSGTGTQGATLRVYLESYEPDVSKQGLDPQDALAPLITLADEVAQIRTLTGRDEP
TVIT
Download sequence
Identical sequences B0C7A9
gi|158338228|ref|YP_001519405.1| WP_012165350.1.67183 329726.AM1_5123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]