SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338300|ref|YP_001519477.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338300|ref|YP_001519477.1|
Domain Number 1 Region: 125-305
Classification Level Classification E-value
Superfamily alpha/beta knot 7.85e-46
Family SpoU-like RNA 2'-O ribose methyltransferase 0.0000437
Further Details:      
 
Domain Number 2 Region: 56-134
Classification Level Classification E-value
Superfamily L30e-like 2.71e-18
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158338300|ref|YP_001519477.1|
Sequence length 309
Comment RNA methyltransferase [Acaryochloris marina MBIC11017]
Sequence
MTKARPSHNNHGKSKPRKPQRSYSSAKKPHRQSTSSRPPQKPRIRSKDKEPAQSEEEQGD
LIYGRHSVLSALEHQRSLNRVWVVSRLRYDPRFHSLLNQAKSQGTIIDEVDHRRLNQLTQ
QATHQGIAAQVAAYEYLDISTLIEQANAATPKPVIIAADSITDPHNLGAMIRTAEALGAQ
GVIIPQRRAAGITSVVAKVATGALETLAIARVVNLNQGLEQLKKAGFWIYGLSTSAPQSI
HTVTFTEPTVLVIGAEGPGLSVSTQHHCDQMVSIPLQGKTASLNASVATGMALYEVYRQR
WVETLHLHP
Download sequence
Identical sequences B0C8K3
WP_012165419.1.67183 329726.AM1_5196 gi|158338300|ref|YP_001519477.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]